PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG004566t1
Common NameTCM_004566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 1028aa    MW: 113162 Da    PI: 8.994
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG004566t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.31.7e-0569125157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +r+R  ++++ ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +R++ +k
  Thecc1EG004566t1  69 KRPRDLLNPKAVKYMQAVFSIKDAISKKESREISALFGVTLTQVRDFFASQRTRVRK 125
                       799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.0966126IPR001356Homeobox domain
SMARTSM003892.8E-468130IPR001356Homeobox domain
SuperFamilySSF466891.37E-668130IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-669138IPR009057Homeodomain-like
CDDcd000861.10E-469126No hitNo description
Gene3DG3DSA:1.20.930.101.7E-4226319IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476766.54E-5227318IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1028 aa     Download sequence    Send to blast
MDVLKENLAE VEIGNTVESL QNFIDLQREL FHSQIDQLQN IVVTQCKLTG VNPLAQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQAVFSIK DAISKKESRE ISALFGVTLT QVRDFFASQR  120
TRVRKQVRLS REKAVRSNAC KETEEGVVLS ESDAMIPVEP VPLNSVGPVN AEEAPSCSTL  180
DDALTGIDEL DKHFVENIFT KMRKEETFSG QVKLLEWILQ IQNPSVLYWF LTKGGVMILA  240
TWLSQAAVEE QTTVLFIILK VLCHLPLQKA LPEQMSAILQ SVNKLCLYRF SDISHRARLL  300
ISRWSKMFAR SQAAKKPNGL KSSADAQNEL LLKQSISEIM GDEPWQSNVD NSEEILATSN  360
VRKLESPQVL KLLPASMDDS TKKNILGVSG SHSRERRKVQ LVEQPGQKMA GKSSQTTRTV  420
PISQSRPMSA DDIQKAKMRA LYMQSKYGKT GSSSNGMNEA KSEGLNKPST SQASFSPPVS  480
KVHVRPAEEQ KKPVILPPKT SNRLGTCLDP KQNMDSKEPP WEKCQKVKIP WHTPPEVKLN  540
ELWRVGAGEN SKEVDVQKNR NRRERETFYY TIQEIPSNPK EPWDREMDYD DTLTPEIPTE  600
QPPDTDSTET QVTHGEHVNS AATLAPSSSH IGGGVAAEPD LELLAVLLKN PALVFALTSG  660
QAGNLTSEET VKLLDMIKAG GAGNSNNIGK NVEEKVEVSL PSPTPSSNPG TSGWKPEAVR  720
NPFSQQSQIG NTVAQASLGV GTTTPVAERL PATSMAAPQQ DANGQLLAQQ LAAAIAQLLP  780
QSSAMTPEKR QSPNVAFSHH GHPSNSPAMQ PPASEIALTL KNLPIANSSL TNLSAAAGPS  840
LRVETLTNVK PAPISMTPNA PEKLHSSFSI SPLMPTLSRP QTPPHLRPQL PQVTDPPLHT  900
HLYSSRPPVG NIGPMSDPWR ARQSLASNPL SQANQTNYNA SFGGSVQPQS RSGPPWEGNE  960
YVGHDGFESW SPENSPNRFS EYVPGRNYLE PRMNSGWSYR PDRSWQRSTP GYRDQNREGN  1020
RRWRDRR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050831.10.0Homeodomain-like superfamily protein, putative
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A061DY790.0A0A061DY79_THECC; Homeodomain-like superfamily protein, putative
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]